Interference No. 105,099 Paper 25 Hannum v. Immunex Corp. Page 6 [17] The disclosed sequence and the claimed sequence differ by the substitution of "Asn" (asparagine) in the claimed sequence for "Xaa" (unknown or other) in the disclosed sequence. [18] Hannum SEQ ID NO:2 is [3002]: Asp Tyr Pro Val Thr Val Ala Val Asn Leu Gln Asp Glu Lys [19] The disclosed sequence and the claimed partial sequence differ by the substitution of "Xaa" (unknown or other) in the claimed sequence for "Asn" (asparagine) in the disclosed sequence. As indicated in the claim, the fourteenth disclosed amino acid residue "Lys" is not included in the claimed partial sequence. [20] Hannum SEQ ID NO:4 is [3002]: Trp Ile Glu Gln Leu Lys Gln Pro Gly Ser [21] As indicated in the claim, the last four disclosed amino acid residues "Gln Pro Gly Ser" are not included in the claimed partial sequence. [22] The Hannum claimed sequences (in bold) match against Immunex SEQ ID NO:28 as follows: Immunex: MTVLAPAWSPNSSLLLLLLLLSPCLRGTPDCYFSHSPISS 40 Immunex: NFKVKFRELTDHLLKDYPVTVAVNLQDEKHCKALWSLFLA 80 SEQ ID NO:2: ...............DYPVTVAVXLQDE............ Immunex: QRWIEQLKTVAGSKMQTLLEDVNTEIHFVTSCTFQPLPEC 120 SEQ ID NO:4: ..WIEQLK................................ Immunex: LRFVQTNISHLLKDTCTQLLALKPCIFKACQNFSRCLEVQ 160 SEQ ID NO:1: ..FVQTNISHLLK........................... Immunex: CQPDSSTLLPPRSPIALEATELPEPRPRQLLLLLLLLPLT 200 8 Each translated into the standard single-letter code for amino acids for easier comparison.Page: Previous 1 2 3 4 5 6 7 8 9 10 11 12 13 NextLast modified: November 3, 2007