Beckmann et al v. Lyman - Page 6



         Interference No. 105,099                                  Paper 25         
         Hannum v. Immunex Corp.                                    Page 6          
    [17] The disclosed sequence and the claimed sequence differ by the substitution of "Asn"
         (asparagine) in the claimed sequence for "Xaa" (unknown or other) in the disclosed
         sequence.                                                                  
    [18] Hannum SEQ ID NO:2 is [3002]:                                              
              Asp Tyr Pro Val Thr Val Ala Val Asn Leu Gln Asp Glu Lys               
    [19] The disclosed sequence and the claimed partial sequence differ by the substitution of
         "Xaa" (unknown or other) in the claimed sequence for "Asn" (asparagine) in the
         disclosed sequence.  As indicated in the claim, the fourteenth disclosed amino acid
         residue "Lys" is not included in the claimed partial sequence.             
    [20] Hannum SEQ ID NO:4 is [3002]:                                              
              Trp Ile Glu Gln Leu Lys Gln Pro Gly Ser                               
    [21] As indicated in the claim, the last four disclosed amino acid residues "Gln Pro Gly Ser"
         are not included in the claimed partial sequence.                          
    [22] The Hannum claimed sequences (in bold) match against Immunex SEQ ID NO:28 as
         follows:                                                                   
              Immunex:    MTVLAPAWSPNSSLLLLLLLLSPCLRGTPDCYFSHSPISS     40           
              Immunex:    NFKVKFRELTDHLLKDYPVTVAVNLQDEKHCKALWSLFLA     80           
              SEQ ID NO:2: ...............DYPVTVAVXLQDE............                 
              Immunex:    QRWIEQLKTVAGSKMQTLLEDVNTEIHFVTSCTFQPLPEC    120           
              SEQ ID NO:4: ..WIEQLK................................                 
              Immunex:    LRFVQTNISHLLKDTCTQLLALKPCIFKACQNFSRCLEVQ    160           
              SEQ ID NO:1: ..FVQTNISHLLK...........................                 
              Immunex:    CQPDSSTLLPPRSPIALEATELPEPRPRQLLLLLLLLPLT    200           
              8  Each translated into the standard single-letter code for amino acids for easier comparison.




Page:  Previous  1  2  3  4  5  6  7  8  9  10  11  12  13  Next 

Last modified: November 3, 2007