Interference No. 105,099 Paper 25 Hannum v. Immunex Corp. Page 7 Immunex: LVLLAAAWGLRWQRARRRGELHPGVPLPSHP 231 [23] The Hannum claimed subsequences are identically contained within Immunex SEQ ID NO:2, and within the range specified in the count (28-163) provided the unknown ("X") in Hannum SEQ ID NO:2 is asparagine ("N") as Hannum discloses in its specification. [24] Neither party appears to be contending that the invention of Immunex 806 claim 49, which is based on Immunex SEQ ID NO:2, anticipates the invention of Hannum 882 claim 28. From this, we infer that the non-sequence physical characteristics recited in Hannum's claim are met by flt3 ligands with sequences similar to Immunex SEQ ID NO:2. [25] The Hannum claimed subsequences are consensus sequences that appear to be based on murine (mouse) isoforms of flt3 ligand [3002 at 8:32-11:38]. [26] Immunex SEQ ID NO:2 is a murine sequence [e.g., 3001 at 0050]. [27] Hannum discloses three separate murine flt3 ligand isoforms (MoT118,9 MoT110,10 and MB8) and two human isoforms (HuS86 and HuS109). The murine isoforms match against Immunex SEQ ID NO:2 as follows (where "." indicates a gap, bold indicates a difference, and underlining indicates the Hannum claimed subsequences): Immunex: MTVLAPAWSPNSSLLLLLLLLSPCLRGTPDCYFSHSPISS 40 MoT118: MTVLAPAWSPNSSLLLLLLLLSPCLRGTPDCYFSHSPISS 40 MoT110: MTVLAPAWSPNSSLLLLLLLLSPCLRGTPDCYFSHSPISS 40 MB8: MTVLAPAWSPNSSLLLLLLLLSPCLRGTPDCYFSHSPISS 40 9 Hannum SEQ ID NO:40. 10 Hannum SEQ ID NO:38Page: Previous 1 2 3 4 5 6 7 8 9 10 11 12 13 NextLast modified: November 3, 2007