Beckmann et al v. Lyman - Page 7




              Interference No. 105,099                                                           Paper 25                 
              Hannum v. Immunex Corp.                                                               Page 7                
                     Immunex:    LVLLAAAWGLRWQRARRRGELHPGVPLPSHP                             231                          
       [23] The Hannum claimed subsequences are identically contained within Immunex SEQ ID                               
              NO:2, and within the range specified in the count (28-163) provided the unknown ("X")                       
              in Hannum SEQ ID NO:2 is asparagine ("N") as Hannum discloses in its specification.                         
       [24] Neither party appears to be contending that the invention of Immunex 806 claim 49,                            
              which is based on Immunex SEQ ID NO:2, anticipates the invention of Hannum 882                              
              claim 28.  From this, we infer that the non-sequence physical characteristics recited in                    
              Hannum's claim are met by flt3 ligands with sequences similar to Immunex SEQ ID                             
              NO:2.                                                                                                       
       [25] The Hannum claimed subsequences are consensus sequences that appear to be                                     
              based on murine (mouse) isoforms of flt3 ligand [3002 at 8:32-11:38].                                       
       [26] Immunex SEQ ID NO:2 is a murine sequence [e.g., 3001 at 0050].                                                
       [27]   Hannum discloses three separate murine flt3 ligand isoforms (MoT118,9 MoT110,10 and                         
              MB8) and two human isoforms (HuS86 and HuS109).  The murine isoforms match                                  
              against Immunex SEQ ID NO:2 as follows (where "." indicates a gap, bold indicates a                         
              difference, and underlining indicates the Hannum claimed subsequences):                                     
                     Immunex: MTVLAPAWSPNSSLLLLLLLLSPCLRGTPDCYFSHSPISS     40                                             
                     MoT118:       MTVLAPAWSPNSSLLLLLLLLSPCLRGTPDCYFSHSPISS     40                                        
                     MoT110:       MTVLAPAWSPNSSLLLLLLLLSPCLRGTPDCYFSHSPISS     40                                        
                     MB8:          MTVLAPAWSPNSSLLLLLLLLSPCLRGTPDCYFSHSPISS     40                                        




                     9  Hannum SEQ ID NO:40.                                                                              
                     10  Hannum SEQ ID NO:38                                                                              





Page:  Previous  1  2  3  4  5  6  7  8  9  10  11  12  13  Next 

Last modified: November 3, 2007